PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA7276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 237aa    MW: 26559.5 Da    PI: 9.7028
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA7276genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.85.7e-343589155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Tp57577_TGAC_v2_mRNA7276 35 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 89
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-323290IPR009057Homeodomain-like
PROSITE profilePS5129412.3473292IPR017930Myb domain
SuperFamilySSF466898.06E-173490IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-243590IPR006447Myb domain, plants
PfamPF002495.8E-83787IPR001005SANT/Myb domain
PfamPF143792.3E-21131170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MERMFPPKKP STMNSHDRPM CVQGDSGLVL TTDPKPRLRW TVELHERFVD AVTQLGGPDK  60
ATPKTIMRVM GVKGLTLYHL KSHLQKFRLG KQPHKEFNDH SIKDGMRATA LELQRNTASS  120
SAMIGRNMNE MQIEVQRRLH EQLEVQKHLQ LRIEAQGKYM QSILEKAYQT LAGENMASAA  180
TNLKGVVVGP HGIPEMGLLK EFGSPLSFSS FQDLDLFGGG GGDQLDLQQN IQKQTLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0515590.0BT051559.1 Medicago truncatula clone MTYF5_F6_F7_F81G-N-14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015932431.11e-157PREDICTED: myb family transcription factor APL isoform X3
SwissprotQ9SAK51e-106APL_ARATH; Myb family transcription factor APL
TrEMBLE5L8F71e-154E5L8F7_LOTJA; IPN2
TrEMBLV7BT531e-154V7BT53_PHAVU; Uncharacterized protein
STRINGGLYMA15G41740.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49643252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-107G2-like family protein